PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr5P13530_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 279aa    MW: 30681.4 Da    PI: 8.7006
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr5P13530_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox597.7e-19130184256
                            T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            rk+ +++k+q  +Lee F+++ ++s +++  LAk+l+L  rqV vWFqNrRa+ k
  GSMUA_Achr5P13530_001 130 RKKLRLSKDQSAVLEESFKEHTTLSPKQKLALAKQLNLRPRQVEVWFQNRRARTK 184
                            788899***********************************************98 PP

2HD-ZIP_I/II126.41.3e-40130219191
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            +kk+rlsk+q+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+eLr
  GSMUA_Achr5P13530_001 130 RKKLRLSKDQSAVLEESFKEHTTLSPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCENLTEENRRLQKEVQELR 217
                            69*************************************************************************************9 PP

            HD-ZIP_I/II  89 eel 91 
                             +l
  GSMUA_Achr5P13530_001 218 -AL 219
                            .55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046186.4E-223102IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.602.6E-19113180IPR009057Homeodomain-like
SuperFamilySSF466891.84E-18120187IPR009057Homeodomain-like
PROSITE profilePS5007117.41126186IPR001356Homeobox domain
SMARTSM003896.1E-17128190IPR001356Homeobox domain
PfamPF000462.6E-16130184IPR001356Homeobox domain
CDDcd000861.33E-15130187No hitNo description
PROSITE patternPS000270161184IPR017970Homeobox, conserved site
SMARTSM003401.5E-26186229IPR003106Leucine zipper, homeobox-associated
PfamPF021832.1E-11186220IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MLLEKEDLAL SLSLSSSANR FDRLGLVPSS SSSPSRSLPS SCQQWSRLLL ARSAGEARRG  60
LRTIDVNQPP PAGAAAGRPD SEEADASSPN SGVSSVGGKR PAEREAEHDA EPSCSRGASD  120
EEEGDGDGSR KKLRLSKDQS AVLEESFKEH TTLSPKQKLA LAKQLNLRPR QVEVWFQNRR  180
ARTKLKQTEV DCEFLKRCCE NLTEENRRLQ KEVQELRALK LSPQLYMQMT PPTTLTMCPS  240
CERVSKPSFS TTSTTNPPPS EAAAPRSLRP PFLDAPPQR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1128134SRKKLRL
2178186RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009400697.11e-179PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotQ054662e-86HAT4_ARATH; Homeobox-leucine zipper protein HAT4
TrEMBLM0SY820.0M0SY82_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr5P13530_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25873889
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.16e-66homeobox protein 2